PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G35910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 1719aa    MW: 185846 Da    PI: 6.1675
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G35910.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like52.61e-16115211891755
          G2-like   17 aveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                       av++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  OPUNC01G35910.1 1152 AVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 1189
                       8****.9*******************************8 PP

2G2-like88.18e-2815741626255
          G2-like    2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                       +r++WtpeLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  OPUNC01G35910.1 1574 ARMVWTPELHHRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 1626
                       79******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF079904.9E-155308722IPR012940Nucleic acid binding NABP
PROSITE profilePS50303133.8557031043IPR033133Pumilio homology domain
SuperFamilySSF483711.02E-1197061039IPR016024Armadillo-type fold
Gene3DG3DSA:1.25.10.103.4E-1407061040IPR011989Armadillo-like helical
CDDcd079201.59E-1707181038IPR033712Pumilio, RNA binding domain
SMARTSM000251.6E-5723758IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030211.417723758IPR001313Pumilio RNA-binding repeat
PfamPF008062.1E-5724757IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030210.974759794IPR001313Pumilio RNA-binding repeat
SMARTSM000258.1E-7759794IPR001313Pumilio RNA-binding repeat
PfamPF008068.6E-7762791IPR001313Pumilio RNA-binding repeat
SMARTSM000255.1E-7795830IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030210.74795830IPR001313Pumilio RNA-binding repeat
PfamPF008061.3E-4796827IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030210.204831866IPR001313Pumilio RNA-binding repeat
SMARTSM000259.5E-8831866IPR001313Pumilio RNA-binding repeat
PfamPF008061.4E-5833864IPR001313Pumilio RNA-binding repeat
SMARTSM000257.5E-7867902IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030210.787867903IPR001313Pumilio RNA-binding repeat
PfamPF008061.7E-8869900IPR001313Pumilio RNA-binding repeat
SMARTSM000251.1E-6904939IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030212.117904939IPR001313Pumilio RNA-binding repeat
PfamPF008065.5E-7905937IPR001313Pumilio RNA-binding repeat
SMARTSM000259.4E-6940975IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503029.481940975IPR001313Pumilio RNA-binding repeat
PfamPF008067.9E-4941967IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030211.0679761017IPR001313Pumilio RNA-binding repeat
SMARTSM000252.1E-79821017IPR001313Pumilio RNA-binding repeat
PfamPF008061.1E-79901016IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030333.03111201451IPR033133Pumilio homology domain
TIGRFAMsTIGR015571.2E-1311521189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.2E-1611521193IPR009057Homeodomain-like
SuperFamilySSF466892.69E-811521193IPR009057Homeodomain-like
SuperFamilySSF483714.26E-5512621446IPR016024Armadillo-type fold
Gene3DG3DSA:1.25.10.102.6E-512621294IPR011989Armadillo-like helical
SMARTSM000251312781310IPR001313Pumilio RNA-binding repeat
Gene3DG3DSA:1.25.10.102.0E-5912951448IPR011989Armadillo-like helical
SMARTSM000251.1E-613121347IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030212.11713121347IPR001313Pumilio RNA-binding repeat
PfamPF008065.5E-713131345IPR001313Pumilio RNA-binding repeat
SMARTSM000259.4E-613481383IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503029.48113481383IPR001313Pumilio RNA-binding repeat
PfamPF008067.9E-413491375IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030211.06713841425IPR001313Pumilio RNA-binding repeat
SMARTSM000252.1E-713901425IPR001313Pumilio RNA-binding repeat
PfamPF008061.1E-713981424IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5129412.29915701629IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2715721630IPR009057Homeodomain-like
SuperFamilySSF466891.77E-1715731630IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2315741626IPR006447Myb domain, plants
PfamPF002498.8E-915751625IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003729Molecular FunctionmRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1719 aa     Download sequence    Send to blast
MISASAVAMR GDMGGGGGDE GELEDELDAL LGTGGGGARR RGEDAGERER ELNMFRSGSA  60
PPTIEGSLNA ISGLLLGGGE AVVTAAAIPD AETLNGHGGL LSEDELRADP AYLSYYYSHG  120
NLNPRLPPPV LSKEDWRSTQ RLKAGVVGGI GDRRKVSPEE TGHEPTVGRP VFSQNAGFDQ  180
EEAARNDVGG AAEWVDGGGD GLIGLSLGRQ RSFADILQDN LGRRTPASEH PSRAASRNSF  240
LDNQELLNSA DNQYSMHNDI LEAQRAVGNV QNVSGLPSIN ASASQTFASV LGSSISRNAT  300
PDSHYVPRVP SPGLPPVGVR INSNEKKLNC SSSFNTVSSK AVEPDDILAA LSNMNMPKDG  360
ALSDGNSISQ SKFQREISDH QNISLDPKAI QVNKNQHSLM LEADTDYLGI PPISQPSNPS  420
FADINKNVAG LTNIRNSTNT RIDGHTEMQR SSTLSTRSYQ KSPSSSNASP GGSPAQHQNI  480
DNINSAFLNY GLSGYPLSPG LPSMMMNCMG SGNMPPLFES AAAASAIASL GADSRNLGNN  540
ILSSPTVSLS DVHNLGRTGN QTATGLLSPL SDPFYVQYLK ATQYAAQGTA NCSDPSLERG  600
FTGSQYGDLT AVQKAYIEAL LQQQKLYGMP LGKSTTSNHG YYGNLAFGMG MAYPGSPLGS  660
PVASPSGPGS PLRLSERNMR FPSNLRNLGG WNSDPSGYMN DNFPSSLLDE FKSNKVRSFE  720
LAEIASHVVE FSADQYGSRF IQQKLETATV EEKDMVFKEI MPQALSLMTD VFGNYVVQKF  780
FEHGSAAQRR ELADQLFGHV LALSLQMYGC RVIQKAIEVV DLDQKTKMVT ELDGHIMRCV  840
RDQNGNHVIQ KCIECVPEDS IQFIISTFYG QVVPLSTHPY GCRVIQRVLE HCTDPKTQEI  900
VMDEILQSVC MLAQDQYGNY VVQHVLEHGK PHERSIIIEK LAGQIIQMSQ QKFASNVVEK  960
CLTFGGPAER EVLINEMLGT TDENEPLQAM MKDQFGNYVV QKVLETCDDQ QRELILSRVK  1020
VHLSALKKYT YGKHIVARRG GLGFRHNILH NGMKMTIRRM VGSAAAAGDA CGRVMEWETG  1080
LPAPGEMTPI SHQLVPPALA AAFGIDLAAV LLPSPSVDSP VSHLFFPVDD EDDDEDDEGE  1140
GGNDDAAAAP PAVAHLGEKG AVPKAIVRLM NVDGLTRENV ASHLQKYRLY LKRTRVAATP  1200
SPSPPPPPPP LPPAMYVPCF AAKPPLDAAN RSDSPPSRTS DATTKHVLYQ KLPRFNIIFP  1260
HHAIEVVDLD QKTKMVTELD GHIMRCVRDQ NGNHRVLEHC TDPKTQEIVM DEILQSVCML  1320
AQDQYGNYVV QHVLEHGKPH ERSIIIEKLA GQIIQMSQQK FASNVVEKCL TFGGPAEREV  1380
LINEMLGTTD ENEPLQAMMK DQFGNYVVQK VLETCDDQQR ELILSRVKVH LSALKKYTYG  1440
KHIVARVMLS ARGGRPHDAD APSPSSSSSS SSPSRRMVGS AAAAGDACGR VMEWETGLPA  1500
PGEMTPISHQ LVPPALAAAF GIDLAAVLLP SPSVDSPVSH LFFPVDDEDD DEDDGRGRGV  1560
TMTPPPPPRT AAAARMVWTP ELHHRFVEAV AHLGEKGAVP KAIVRLMNVD GLTRENVASH  1620
LQKYRLYLKR TRVAATPSPS PPPPPPPLPP AMYVPCFAAK PPLDAANRSD SPPSRTSDAT  1680
TKQGENATRS RRAWAPETNP QFVAGSATRA PPSRSRVGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gvo_A1e-13270514485339Pumilio homolog 2
3gvt_A1e-13270514485339Pumilio homolog 2
3gvt_B1e-13270514485339Pumilio homolog 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0998010.0AK099801.1 Oryza sativa Japonica Group cDNA clone:J013098A15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611225.10.0PREDICTED: pumilio homolog 1
SwissprotQ9ZW070.0PUM1_ARATH; Pumilio homolog 1
TrEMBLA0A0E0JQY10.0A0A0E0JQY1_ORYPU; Uncharacterized protein
STRINGORGLA01G0308900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1412922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.18e-24G2-like family protein